3.05 Rating by CuteStat

freedailysudoku.net is 1 decade 8 years old. It is a domain having net extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, freedailysudoku.net is SAFE to browse.

PageSpeed Score
83
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

23.229.194.8

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
Texans Rock | Where it's bigger and better!

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 6
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 23.229.194.8)

Coming Soon - Future home of something quite cool

- pitchtofund.com
Not Applicable $ 8.95

Coming Soon

- alnada-bdc.com
Not Applicable $ 8.95

ACS Roofing Company | (832) 593-0027

- acsroofingcompany.com

This is valuable website which provides the information about the ACS Roofing Company.

13,213,249 $ 8.95

Accent Builders DFW

- accentbuildersdfw.com

This is a valuable website which provides information about the Accent Builder DFW

Not Applicable $ 8.95

Lawn Sprinkler System in Cincinnati | Paramount Landscaping (513) 984-

- cincinnatilawnsprinklersystem.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Fri, 09 Jun 2017 12:10:50 GMT
Server: Apache/2.4.25
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Powered-By: PHP/5.5.9-1ubuntu4.14
X-Pingback: http://www.FREEDAILYSUDOKU.NET/xmlrpc.php
Link: <http://www.FREEDAILYSUDOKU.NET/>; rel=shortlink
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 3904
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: Dec 19, 2005, 12:00 AM 1 decade 8 years 4 months ago
Last Modified: Nov 30, 2016, 12:00 AM 7 years 4 months 3 weeks ago
Expiration Date: Dec 19, 2017, 12:00 AM 6 years 4 months 3 days ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns03.domaincontrol.com 97.74.101.2 United States of America United States of America
ns04.domaincontrol.com 173.201.69.2 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
freedailysudoku.net A 587 IP: 23.229.194.8
freedailysudoku.net NS 3599 Target: ns04.domaincontrol.com
freedailysudoku.net NS 3599 Target: ns03.domaincontrol.com
freedailysudoku.net SOA 3599 MNAME: ns03.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2016050200
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 600
freedailysudoku.net MX 3599 Target: mail.freedailysudoku.net
freedailysudoku.net TXT 3599 TXT: v=spf1 a mx ptr include:secureserver.net
~all

Full WHOIS Lookup

Domain Name: FREEDAILYSUDOKU.NET
Registrar URL: http://www.godaddy.com
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Name Server: NS03.DOMAINCONTROL.COM
Name Server: NS04.DOMAINCONTROL.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=FREEDAILYSUDOKU.NET

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.